Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Novus Biologicals™ DNAJB5 Recombinant Protein Antigen
Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
Supplier: Novus Biologicals™ NBP258535PEP
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DNAJB5. Source: E.coli Amino Acid Sequence: IDGRVIPLPCNDVIKPGTVKRLRGEGLPFPKVPTQRGDLIVEFKVRFPDRLTPQTRQILKQHLPCS The DNAJB5 Recombinant Protein Antigen is derived from E. coli. The DNAJB5 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.Specifications
| 25822 | |
| DNAJB5 Recombinant Protein Antigen | |
| PBS and 1M Urea, pH 7.4. | |
| DnaJ (Hsp40) homolog, subfamily B, member 5, heat shock cognate 40, Heat shock protein cognate 40, Heat shock protein Hsp40-2, Heat shock protein Hsp40-3, HSC40, Hsc40dnaJ homolog subfamily B member 5, KIAA1045 | |
| Unlabeled | |
| 100μL | |
| E.Coli |
| >80% by SDS-PAGE and Coomassie blue staining | |
| Store at −20C. Avoid freeze-thaw cycles. | |
| Blocking/Neutralizing, Control | |
| DNAJB5 | |
| Recombinant Protein Antigen | |
| RUO | |
| Human |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
For Research Use Only