Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Our pricing system is unavailable. You are viewing list price.
Please call 1-800-766-7000 to place your order or try our site again later.

Novus Biologicals™ EEF2K Recombinant Protein Antigen

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

Manufacturer:  Novus Biologicals™ NBP258790PEP

Catalog No. NBP258790PE



Description

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human EEF2K. Source: E.coli Amino Acid Sequence: GFDYLLKAAEAGDRQSMILVARAFDSGQNLSPDRCQDWLEALHWYNTALEMTDCDEGGEYDGMQDEPRYMMLAREAEMLFTG The EEF2K Recombinant Protein Antigen is derived from E. coli. The EEF2K Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Specifications

Specifications

Blocking/Neutralizing, Control
29904
>80% by SDS-PAGE and Coomassie blue staining
E.coli
RUO
EEF2K
Unlabeled
Yes
PBS and 1M Urea, pH 7.4.
EEF2K Recombinant Protein Antigen
100μL
Store at −20°C. Avoid freeze-thaw cycles.
Calcium/calmodulin-dependent eukaryotic elongation factor 2 kinase, calcium/calmodulin-dependent eukaryotic elongation factor-2 kinase, EC 2.7.11, EC 2.7.11.20, eEF-2 kinase, eEF-2Kcalmodulin-dependent protein kinase III, elongation factor-2 kinase, eukar
Recombinant Protein Antigen
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only.