Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CPC Scientific H-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 (trifluoroacetate salt) 0.5MG
Supplier: CPC Scientific EXED002A
Exendin (9-39) is a selective and potent against glucagon-like peptide 1 (GLP-1) and inhibits (Kd = 1.7 nm) cAMP production caused by Gastric Inhibitory Peptide (GIP). Exendin (9-39) is involved in appetite modulation by reducing insulin secretion and helps prevent sharp falls in glucose levels. This peptide has been studied for its? effects on the permeability of basal microvascular.SEQUENCE: H-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 (trifluoroacetate salt)ONE-LETTER SEQUENCE: DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2MOLECULAR FORMULA: C149H234N40O47SMOLECULAR WEIGHT: 3369.79STORAGE CONDITIONS: -20 5 CCAS REGISTRY NUMBER: [133514-43-9]SYNONYMS: Exendin-(9-39)RESEARCH AREA: DiabetesREFERENCES:Greig, NH. et al. Diabetolog 42, 45 (1999)Montrose-Rafizadeh, C. et al. J Biol Chem 272, 21201 (1997)Gke R. et al. J Biol Chem 268, 19650 (1993)Eng, J. et al. J Biol Chem 267, 7402 (1992)
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?