Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CPC Scientific H-Phe-Asn-Lys-His-Thr-Glu-Ile-Ile-Glu-Glu-Asp-Thr-Asn-Lys-Asp-Lys-Pro-Ser-Tyr-Gln-Phe-Gly-Gly-His-Asn-Ser-Val-Asp-Phe-Glu-Glu-Asp-Thr-Leu-Pro-Lys-Val-OH (trifluoroacetate salt) 0.5MG
Supplier: CPC Scientific FIBN008A
A synthetic peptide that mimics the structure of a 38-amino acid unit from a staphylococcal fibronectin-binding protein. This peptide represents the protein domain to which the fibronectin-binding activity has been localized and also inhibits the binding of fibronectin to bacterial cells.SEQUENCE: H-Phe-Asn-Lys-His-Thr-Glu-Ile-Ile-Glu-Glu-Asp-Thr-Asn-Lys-Asp-Lys-Pro-Ser-Tyr-Gln-Phe-Gly-Gly-His-Asn-Ser-Val-Asp-Phe-Glu-Glu-Asp-Thr-Leu-Pro-Lys-Val-OH (trifluoroacetate salt)ONE-LETTER SEQUENCE: FNKHTEIIEEDTNKDKPSYQFGGHNSVDFEEDTLPKVMOLECULAR FORMULA: C190H283N49O66MOLECULAR WEIGHT: 4309.7STORAGE CONDITIONS: -20 5 CCAS REGISTRY NUMBER: [119977-20-7]SYNONYMS: RESEARCH AREA: InflammationREFERENCES:C. Signas et al., PNAS, 86, 699 (1989)SKU(s): FIBN-008A, FIBN-008B
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?