Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

AnaSpec FLUORESCEIN-?-AMYLOID (1-42)

Supplier:  AnaSpec AS2352601

Encompass

Beta-Amyloid (1-42), FAM-labeled, Human[FAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA] ; MW 4873.4; (0.1 mg) This is a fluorescent (FAM)-labeled B-Amyloid peptide, Abs/Em=494/521 nm.

Catalog No. 50-824-541


May include imposed supplier surcharges.
Add to Cart

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.