Learn More
Medchemexpress LLC HY-P1229 1mg Medchemexpress, FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS CAS: Purity:>98%

Supplier: Medchemexpress LLC HYP12291MG
Medchemexpress, HY-P1229 1mg FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS CAS: FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative. Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.