Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Medchemexpress LLC HY-P1229 1mg Medchemexpress, FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS CAS: Purity:>98%
SDP

Supplier:  Medchemexpress LLC HYP12291MG

Encompass_Preferred

Medchemexpress, HY-P1229 1mg FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS CAS: FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative. Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.

Catalog No. 50-193-4170


Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.