Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 89945227

Abnova™ fur (Escherichia coli) Recombinant Protein

Catalog No. 89945227 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-945-227 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-945-227 Supplier Abnova™ Supplier No. P4972
Only null left
Add to Cart
Add to Cart

Description

Used for SDS-PAGE

Sequence: MTDNNTALKKAGLKVTLPRLKILEVLQEPDNHHVSAEDLYKRLIDMGEEIGLATVYRVLNQFDDAGIVTRHNFEGGKSVFELTQQHHHDHLICLDCGKVIEFSDDSIEARQREIAAKHGIRLTNHSLYLYGHCAEGDCREDEHAHEGK

Specifications

Accession Number NP_415209
Concentration 1 mg/mL
For Use With (Application) SDS-PAGE
Formulation Liquid
Gene ID (Entrez) 945295
Molecular Weight (g/mol) 42kDa
Name fur (Escherichia coli) Recombinant protein
Preparation Method Escherichia coli expression system
Purification Method Conventional Chromatography
Quality Control Testing 15% SDS-PAGE Stained with Coomassie Blue
Quantity 100 μg
Immunogen MTDNNTALKKAGLKVTLPRLKILEVLQEPDNHHVSAEDLYKRLIDMGEEIGLATVYRVLNQFDDAGIVTRHNFEGGKSVFELTQQHHHDHLICLDCGKVIEFSDDSIEARQREIAAKHGIRLTNHSLYLYGHCAEGDCREDEHAHEGK
Storage Requirements Store at -20°C. For long term storage store at -80°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Gene Alias ECK0671/JW0669
Common Name fur
Gene Symbol fur
Species E. coli
Protein Tag None
Expression System Escherichia coli expression system
Form Liquid
Purity or Quality Grade >95% by SDS-PAGE
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.