Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CPC Scientific H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu-Thr-Ser-OH (trifluoroacetate salt) 1MG
Supplier: CPC Scientific GALA001B
Human galanin, originally been isolated from colon and pituitary, that activates the rat galanin receptor and inhibits acetylcholine release, glutamate release and carbachol-stimulated phosphatidylinositol hydrolysis in the hippocampus. Recent studies indicated that galanin is also linked to behavioral and cognitive deficits in Alzheimer's disease. ONE-LETTER SEQUENCE: GWTLNSAGYLLGPHAVGNHRSFSDKNGLTSMOLECULAR FORMULA: C139H210N42O43MOLECULAR WEIGHT:3157.45STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [119418-04-1], RESEARCH AREA: Alzheimer's DiseaseREFERENCES: W.E. Schmidt et al., PNAS, 88, 11435 (1991)
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?