Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. 502109353

CPC Scientific H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH 0.5MG
SDP

Supplier:  CPC Scientific GIPS001A

Encompass

Incretion is an essential regular of insulin secretion and glucose.SEQUENCE: H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OHONE-LETTER SEQUENCE: YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQMOLECULAR FORMULA: C226H338N60O66S1MOLECULAR WEIGHT: 4983.60STORAGE CONDITIONS: -20 5 CCAS REGISTRY NUMBER: [10040-31-1]SYNONYMS: GIP (human), Glucose-Dependent Insulinotropic Polypeptide (human), GIP (1-42) (human), Gastric Inhibitory Polypeptide (human)RESEARCH AREA: DiabetesREFERENCES:A. Moody et al., FEBS Letters, 123, 205 (1981)SKU(s): GIPS-001A, GIPS-001B

Catalog No. 50-210-9353


May include imposed supplier surcharges.
Add to Cart

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.