Learn More
CPC Scientific H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-NH2 (trifluoroacetate salt) 0.5MG

Supplier: CPC Scientific GIPS002A
GIP fragment that presents potent insulinotropic activity in the isolated perfused rat pancreas, but greatly inhibits somatostatinotropic activity in the isolated perfused rat stomach. The site responsible for insulinotropic activity lies between 19 and 30 of GIP. ONE-LETTER SEQUENCE: YAEGTFISDYSIAMDKIRQQDFVNWLLAQK-NH2MOLECULAR FORMULA: C162H245N41O47S1MOLECULAR WEIGHT:3551.04STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [134846-93-8], SYNONYMS: Gastric Inhibitory Polypeptide (1-30) amide (porcine), Glucose-Dependent Insulinotropic Polypeptide (1-30) amide (porcine), GIP (1-30) amide (porcine)RESEARCH AREA: DiabetesREFERENCES: W.J.Rossowski et al., Reg. Pep., 39, 9 (1992)
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.