Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. 502109334

CPC Scientific H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 (acetate salt) 1MG
SDP

Supplier:  CPC Scientific GHRF001B

Encompass

Shortest GRF fragment with full biological activity.ONE-LETTER SEQUENCE: YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2MOLECULAR FORMULA: C149H246N44O42S1MOLECULAR WEIGHT:3358STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [86168-78-7], RESEARCH AREA: HormonalREFERENCES: V.A. Lance et al., Biochem. Biophys. Res. Commun., 119, 265 (1984)

Catalog No. 50-210-9334


May include imposed supplier surcharges.
Add to Cart

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.