Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. 502109389

CPC Scientific H-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 (trifluoroacetate salt) 1MG
SDP

Supplier:  CPC Scientific GLUC017B

Encompass

GLP-1 (9-36) is a truncated product from the degradation of GLP-1 (7-36) by dipeptidyl peptidase IV (DPP-4). The peptide is an antagonist to the GLP-1 (human) receptor and inhibits hepatic glucose production.ONE-LETTER SEQUENCE: EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2MOLECULAR FORMULA: C140H214N36O43MOLECULAR WEIGHT:3089.44STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [ 161748-29-4 ], RESEARCH AREA: DiabetesREFERENCES: Ban, K. et. al. Endocrinol 151, 1520 (2010); John, H. et al. Eur J Med Res 13, 73 (2008); Elahi, D. et. al. Obesity (Silver Spring) 16, 1501 (2008)

Catalog No. 50-210-9389


May include imposed supplier surcharges.
Add to Cart

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.