Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CPC Scientific H-His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OH (trifluoroacetate salt) 1MG
Supplier: CPC Scientific GLUC008B
GLP, synthesized by posttranslational processing of proglucagon in the intestine and pancreas, plays an important role in metabolic homeostasis. It is capable of converting intestinal epithelial cells into insulin-producing cells, thus serving as a new putative therapeutic compound for the treatment of diabetes mellitus. ONE-LETTER SEQUENCE: HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGMOLECULAR FORMULA: C186H275N51O59MOLECULAR WEIGHT:4169.6STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [87805-34-3], RESEARCH AREA: DiabetesREFERENCES: G.I. Bell et al., Nature, 304, 368 (1983)
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?