Learn More
CPC Scientific H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OH 0.5MG

Supplier: CPC Scientific GLUC016A
GLP-1 (7-37) is a insulinotropic peptide generated from by precursor GLP-1 (1-37) after proteolytic cleavage. It is secreted by the L cells of intestinal mucosa after food ingestion.SEQUENCE: H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OHONE-LETTER SEQUENCE: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGMOLECULAR FORMULA: C151H228N40O47MOLECULAR WEIGHT: 3355.7STORAGE CONDITIONS: -20 5 CCAS REGISTRY NUMBER: [106612-94-6]SYNONYMS: Preproglucagon (98-128), Insulinotropin acetate salt, Proglucagon (78-108), Glucagon-Like Peptide 1 (7-37), GLP-1 (7-37) (human, bovine, guinea pig, mouse, rat)RESEARCH AREA: DiabetesREFERENCES:A.Wettergren et al., Regul. Peptides, 77, 83 (1998)A.B.Damholt et al., Endocrinology, 140, 4800 (1999)J.M.Conlon, Regul. Peptides, 93 3 (2000)D.J.Drucker, Gut, 50, 428 (2002)D.J.Drucker, Gastroenterology, 122, 531 (2002)SKU(s): GLUC-016A, GLUC-016B
The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.