Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. 502109366

CPC Scientific H-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-OH (trifluoroacetate salt) 1MG
SDP

Supplier:  CPC Scientific GLUC004B

Encompass

A 29 amino acid sequence containing peptide hormone processed from proglucagon that keeps glucose homeostasis in vivo in both animals and humans. It is also believed to be a potential tool in the therapeutic treatment of diabetes.SEQUENCE: H-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-OH (trifluoroacetate salt)ONE-LETTER SEQUENCE: HSQGTFTSDYSKYLDSRRAQDFVQWLMNTMOLECULAR FORMULA: C153H225N43O49S1MOLECULAR WEIGHT: 3482.8STORAGE CONDITIONS: -20 5 CCAS REGISTRY NUMBER: [16941-32-5]SYNONYMS: Glucagon (1-29) (human, rat, porcine)RESEARCH AREA: DiabetesREFERENCES:S.Onoue et al., J. Chromatogr. A, 1109, 167 (2006)G.Jiang and B.B. Zhang, Am. J. Physiol. Endocrinol. Metab., 284, E671 (2003)SKU(s): GLUC-004A, GLUC-004B

Catalog No. 50-210-9366


May include imposed supplier surcharges.
Add to Cart

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.