Invitrogen™ Human 14-3-3 beta (aa 95-161) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP89530	100 μL

Catalog No. RP89530 Supplier Invitrogen™ Supplier No. RP89530

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

14-3-3, a family of acidic and soluble proteins, highly conserved in amino acid sequences from yeast to mammals, is expressed in all eukaryotic cells. Seven isoforms(beta, gamma, epsilon, eta, zeta, sigma and tau/theta) encoded by seven distinct genes are identified in mammals and forms homo- and hetero- dimeric cup-shaped structures. As 14-3-3 is interacted with more than 100 binding partners, it regulates key proteins involved in various biological processes such as signal trans-duction, cell cycle, transcriptional control, cell proliferation, apoptosis, and ion channel physiology. Most 14-3-3 requires phosphorylation of serine or threonine residues in the target sequence. This protein is abundantly expressed in the brain and has been detected in the cerebrospinal fluid of patients with different neurological disorders.

Specifications

• Accession Number: P31946
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 7529
• Name: Human 14-3-3 beta (aa 95-161) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 1300003C17Rik; 14-3-3 alpha; 14-3-3 protein beta; 14-3-3 protein beta/alpha; 14-3-3 protein beta/alpha, N-terminally processed; 14-3-3 protein beta-subtype; 3-monooxygenase/tryptophan 5 monooxygenase activation protein beta polypeptide; brain protein 14-3-3, beta isoform; epididymis secretory protein Li 1; GW128; HEL-S-1; HS1; hypothetical protein GW128; KCIP 1; KCIP1; KCIP-1; Prepronerve growth factor RNH-1; protein 1054; Protein kinase C inhibitor protein 1; protein kinase C inhibitor protein-1; QccE-16215; RP1-148E22.1; tryosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein beta polypeptide; tryosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein gamma; tyrosine 3/tryptophan 5 -monooxygenase activation protein beta polypeptide; tyrosine 3/tryptophan 5 -monooxygenase activation protein, beta polypeptide; tyrosine 3-monooxgenase/tryptophan 5 monooxgenase activation protein beta polypeptide; tyrosine 3-monooxgenase/tryptophan 5 monooxgenase activation protein, beta polypeptide; tyrosine 3-monooxgenase/tryptophan 5-monooxgenase activation protein, beta polypeptide; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein beta; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, alpha polypeptide; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide; unnamed protein product; YWHAA; Ywhab
• Common Name: 14-3-3 beta
• Gene Symbol: YWHAB
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining