Invitrogen™ Human 4-1BB Ligand (aa 158-248) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP106972	100 μL

Catalog No. RP106972 Supplier Invitrogen™ Supplier No. RP106972

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (26%), Rat (26%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66287. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CD137 ligand (CD137L) is a type II membrane protein and part of the TNF superfamily. CD137L is a co-stimulatory molecule that is expressed on antigen presenting cells (DCs, monocytes/macrophages, B cells) and is upregulated upon activation. Its receptor, CD137/4-1BB, is found on a variety of cells, including inflamed endothelial cells, where its expression enhances extravasation of CD137L expressing monocytes. Activated T cells also express CD137, and engagement with CD137L enhances T cell proliferation, IL-2 secretion, survival, and cytotoxic activity. CD137L is also expressed on a majority of B-cell lymphomas, including mantle cell lymphoma, follicular lymphoma, and diffuse large B-cell lymphoma (but it is lacking on Hodgkin lymphoma and T-cell lymphoma). CD137L is also expressed in carcinoma cell lines, and is thought to be involved in T cell-tumor cell interactions.

Specifications

• Accession Number: P41273
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 8744
• Name: Human 4-1BB Ligand (aa 158-248) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 4 1 BB Ligand; 4 1 BBL; 41BB Ligand; 4-1BB ligand; 41BBL; 4-1BBL; 4-1BB-L; AI848817; CD 137 Ligand; CD 137L; CD137 Ligand; CD137L; Cd157l; CDw137L; costimulatory molecule; homolog of mouse 4-1BB-L; Ly63l; receptor 4-1BB ligand; TNFRSF9; Tnfsf9; TNLG5A; tumor necrosis factor (ligand) superfamily member 9; tumor necrosis factor (ligand) superfamily, member 9; tumor necrosis factor ligand 5A; tumor necrosis factor ligand superfamily member 9; tumor necrosis factor superfamily member 9
• Common Name: 4-1BBL (CD137L)
• Gene Symbol: TNFSF9
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining