Invitrogen™ Human AADACL4 (aa 291-351) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP99832	100 μL

Catalog No. RP99832 Supplier Invitrogen™ Supplier No. RP99832

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (64%), Rat (64%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60427. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Arylacetamide deacetylase-like 4 is a protein in humans that is encoded by the AADACL4 gene. It belongs to the 'GDXG' lipolytic enzyme family. The subcellular location of this protein in the membrane, it is single-pass type II membrane protein. It has signal-anchor, transmembrane and transmembrane helix domain. Functions as Hydrolase.

Specifications

• Accession Number: Q5VUY2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 343066
• Name: Human AADACL4 (aa 291-351) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: Aadacl4; arylacetamide deacetylase like 4; arylacetamide deacetylase-like 4; Gm13177; OTTMUSG00000010747; predicted gene 13177; RGD1565761
• Common Name: AADACL4
• Gene Symbol: AADACL4
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PKKFKNRGYQPWSPGPFNEAAYLEAKHMLDVENSPLIADDEVIAQLPEAFLVSCENDILRD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining