Invitrogen™ Human AADAT (aa 84-169) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP96623	100 μL

Catalog No. RP96623 Supplier Invitrogen™ Supplier No. RP96623

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83374. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein that is highly similar to mouse and rat kynurenine aminotransferase II. The rat protein is a homodimer with two transaminase activities. One activity is the transamination of alpha-aminoadipic acid, a final step in the saccaropine pathway which is the major pathway for L-lysine catabolism. The other activity involves the transamination of kynurenine to produce kynurenine acid, the precursor of kynurenic acid which has neuroprotective properties. Two alternative transcripts encoding the same isoform have been identified, however, additional alternative transcripts and isoforms may exist.

Specifications

• Accession Number: Q8N5Z0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 51166
• Name: Human AADAT (aa 84-169) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2-aminoadipate aminotransferase; 2-aminoadipate transaminase; AadAT; Aadt; AI875679; alpha-aminoadipate aminotransferase; aminoadipate aminotransferase; KAT/AadAT; Kat2; KATII; KYAT2; kynurenine aminotransferase 2; kynurenine aminotransferase II; kynurenine/alpha-aminoadipate aminotransferase, mitochondrial; kynurenine--oxoglutarate; Kynurenine--oxoglutarate aminotransferase II; kynurenine--oxoglutarate transaminase 2; Kynurenine--oxoglutarate transaminase II; L kynurenine/alpha aminoadipate aminotransferase; mKat-2
• Common Name: AADAT
• Gene Symbol: Aadat
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining