Invitrogen™ Human ABCA7 (aa 311-396) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP98889	100 μL

Catalog No. RP98889 Supplier Invitrogen™ Supplier No. RP98889

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (62%), Rat (62%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59624. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ATP-binding cassette (ABC) transporters are an evolutionarily conserved family that use ATP hydrolysis to catalyze the transport of various molecules across cell membranes. They are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). ABCA7, a member of the ABC1 subfamily, is a full-size ABC transporter consisting of two sets of the multiple membrane-spanning domains plus the Walker motifs for the ATP interaction. ABCA7 shows the highest homology to ABCA1, an essential molecule for cholesterol homeostasis. The high expression levels of ABCA7 in peripheral leukocytes, thymus, spleen and bone marrow suggests a role in the immune system lipid homeostasis.

Specifications

• Accession Number: Q8IZY2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 10347
• Name: Human ABCA7 (aa 311-396) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: ABC 1 antibody; ABC Transporter 1; ABC1; ABC1 antibody; Abc51; Abca7; ABCA-SSN; ABCX; AD9; ATP binding cassette subfamily A member 7; ATP-binding cassette sub-family A member 7; ATP-binding cassette sub-family A member 7; LOW QUALITY PROTEIN: ATP-binding cassette sub-family A member 7; ATP-binding cassette, subfamily A (ABC1), member 7; ATP-binding cassette, sub-family A (ABC1), member 7; ATP-binding cassette, sub-family A, member 7; autoantigen SS-N; CERP; CERP antibody; EC 2.2.1.1; EC 3.6.3; EC 3.6.3.41; FLJ40025; Macrophage ABC transporter; Phospholipid-transporting ATPase ABCA7; phospholipid-transporting ATPase ABCA7; ATP-binding cassette sub-family A member 7
• Common Name: ABCA7
• Gene Symbol: Abca7
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VNRTFEELTLLRDVREVWEMLGPRIFTFMNDSSNVAMLQRLLQMQDEGRRQPRPGGRDHMEALRSFLDPGSGGYSWQDAHADVGHL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining