Invitrogen™ Human ABCB9 (aa 731-766) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP105896	100 μL

Catalog No. RP105896 Supplier Invitrogen™ Supplier No. RP105896

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65139. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The structure specific ERCC 1 / XPF endonuclease complex is implicated in the repair of two distinct types of lesions in DNA: NER for UV induced lesions and bulky chemical adducts; and recombination repair of the very genotoxic interstrand cross links. NER mechanism involves dual incisions on both sides of the damage catalyzed by two nucleases. In mammalian cells, XPG cleaves 3' of the DNA lesion while the ERCC1 / XPF complex makes the 5' incision. ERCC1 / XPF probably plays a role in processing partially processed recombination intermediates.

Specifications

• Accession Number: Q9NP78
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 23457
• Name: Human ABCB9 (aa 731-766) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: ABC transporter 9 protein; ABCB9; ATP binding cassette subfamily B member 9; ATP-binding cassette sub-family B member 9; ATP-binding cassette transporter 9; ATP-binding cassette, subfamily B (MDR/TAP), member 9; ATP-binding cassette, sub-family B (MDR/TAP), member 9; ATP-binding cassette, sub-family B, member 9; EST122234; KIAA1520; LOW QUALITY PROTEIN: ATP-binding cassette sub-family B member 9; mABCB9; mKIAA1520; TAPL; TAP-like ABC transporter; TAP-like protein
• Common Name: ABCB9
• Gene Symbol: ABCB9
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GGLYAKLVQRQMLGLQPAADFTAGHNEPVANGSHKA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining