Invitrogen™ Human ABCC11 (aa 1096-1174) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP102605	100 μL

Catalog No. RP102605 Supplier Invitrogen™ Supplier No. RP102605

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (49%), Rat (49%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111034. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ABCC11 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This ABC full transporter is a member of the MRP subfamily which is involved in multi-drug resistance. The product of this gene participates in physiological processes involving bile acids, conjugated steroids, and cyclic nucleotides. In addition, a SNP in this gene is responsible for determination of human earwax type. This gene and family member ABCC12 are determined to be derived by duplication and are both localized to chromosome 16q12.1. Multiple alternatively spliced transcript variants have been described for this gene.

Specifications

• Accession Number: Q96J66
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 85320
• Name: Human ABCC11 (aa 1096-1174) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: ABCC11; ATP binding cassette subfamily C member 11; ATP-binding cassette protein C11; ATP-binding cassette sub-family C member 11; ATP-binding cassette transporter MRP8; ATP-binding cassette transporter sub-family C member 11; ATP-binding cassette, sub-family C (CFTR/MRP), member 11; EWWD; MRP8; multidrug resistance-associated protein 8; multi-resistance protein 8; WW
• Common Name: ABCC11
• Gene Symbol: ABCC11
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RIGLETEAQFTAVERILQYMKMCVSEAPLHMEGTSCPQGWPQHGEIIFQDYHMKYRDNTPTVLHGINLTIRGHEVVGIV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining