Invitrogen™ Human ABI3BP (aa 198-299) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP100173	100 μL

Catalog No. RP100173 Supplier Invitrogen™ Supplier No. RP100173

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83706. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ABI3BP is a protein coding gene. Gene ontology (GO) annotation include collagen-containing extracellular matrix; extracellular region; extracellular space; interstitial matrix.

Specifications

• Accession Number: Q7Z7G0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 25890
• Name: Human ABI3BP (aa 198-299) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 5033411B22Rik; ABI family member 3 binding protein; ABI family, member 3 (NESH) binding protein; ABI gene family member 3-binding protein; ABI gene family, member 3 (NESH) binding protein; ABI3BP; AI506287; BG172926; D930038M13Rik; eratin; FLJ41743; FLJ41754; Nesh-binding protein; NESHBP; RGD1562717; Target of Nesh-SH3; Tarsh
• Common Name: ABI3BP
• Gene Symbol: ABI3BP
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VEGGIWSKIFNHKTVVGSKKVNGKIQSTYDQDHTVPAYVPRKLIPITIIKQVIQNVTHKDSAKSPEKAPLGGVILVHLIIPGLNETTVKLPASLMFEISDAL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining