Invitrogen™ Human Aconitase 1 (aa 570-658) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP92936	100 μL

Catalog No. RP92936 Supplier Invitrogen™ Supplier No. RP92936

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Aconitase 1 (ACO1) also known as iron regulatory element binding protein 1 (IREB1), is a cytosolic protein which binds to iron-responsive elements (IREs). It plays a central role in cellular iron homeostasis. It was also shown to have aconitase activity, and hence grouped with the aconitase family of enzymes.Aconitase 1, also known as iron regulatory element binding protein 1 (IREB1), is a cytosolic protein which binds to iron-responsive elements (IREs). IREs are stem-loop structures found in the 5' UTR of ferritin mRNA, and in the 3' UTR of transferrin receptor mRNA. The iron-induced binding to the IRE results in repression of translation of ferritin mRNA, and inhibition of degradation of the otherwise rapidly degrading transferrin receptor mRNA. Thus, IREB1 plays a central role in cellular iron homeostasis. It was also shown to have aconitase activity, and hence grouped with the aconitase family of enzymes.

Specifications

• Accession Number: P21399
• Concentration: 1.10 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 48
• Name: Human Aconitase 1 (aa 570-658) Control Fragment
• pH Range: 7.4
• Purification Method: Metal-chelate chromatography
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: ACO1; Aco-1; Acon1; Aconitase; aconitase 1; aconitase 1, soluble; aconitate hydratase, cytoplasmic; ACONS; AH; Citrate hydro-lyase; cytoplasmic aconitase; cytoplasmic aconitate hydratase; cytosplasmic aconitase; epididymis luminal protein 60; ferritin repressor protein; FRP; HEL60; Ireb1; Irebp; IRE-BP 1; IREBP1; iron regulatory protein 1; iron-responsive element binding protein 1; iron-responsive element-binding protein 1; IRP1; OTTHUMP00000021176; OTTHUMP00000021177; OTTHUMP00000045233; soluble aconitase
• Common Name: Aconitase 1
• Gene Symbol: ACO1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FEKEPLGVNAKGQQVFLKDIWPTRDEIQAVERQYVIPGMFKEVYQKIETVNESWNALATPSDKLFFWNSKSTYIKSPPFFENLTLDLQP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining