Invitrogen™ Human ADAMTS10 (aa 797-874) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP93161	100 μL

Catalog No. RP93161 Supplier Invitrogen™ Supplier No. RP93161

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59109. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ADAMTS (a disintegrin and metalloproteinase domain with Thrombospondin type-1 modules) is a family of zinc-dependent proteases that are implicated in a variety of normal and pathological conditions, including arthritis and cancer (1-3). Embryogenesis, morphological growth changes, inflammation, tumor invasion and metastasis involve the breakdown and remodeling of the extracellular matrix. This degradation is due to the family of enzymes known as the matrix metalloproteinases (MMPs), which are related to ADAMTS subtypes. ADAMTS protein family members contain an amino-terminal propeptide domain, a metalloproteinase domain, a disintegrin-like domain and a carboxy-terminus that contains a varying number of thrombospondin type-1 (TSP-1) motifs (1-3). ADAMTS genes are primarily expressed in fetal tissues, including the lung, kidney and liver (1-3). The human ADAMTS10 gene maps to chromosome 19p13.3 (4). The human ADAMTS19 gene maps to chromosome 5q31 (1,5).

Specifications

• Accession Number: Q9H324
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 81794
• Name: Human ADAMTS10 (aa 797-874) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 9430006O18; a disintegrin and metalloproteinase; A disintegrin and metalloproteinase with thrombospondin motifs 10; a disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 10; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 10; a disintegrin-like and metalloprotease with thrombospondin type 1 motif, 10; ADAM; ADAM metallopeptidase with thrombospondin type 1 motif 10; ADAM metallopeptidase with thrombospondin type 1 motif, 10; ADAMs; ADAM-TS 10; ADAMTS10; Adam-ts10; ADAMTS-10; AW045948; metalloendopeptidases; WMS; WMS1; zinc metalloendopeptidase; Znmp
• Common Name: ADAMTS10
• Gene Symbol: ADAMTS10
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SLIVMVLARTELPALRYRFNAPIARDSLPPYSWHYAPWTKCSAQCAGGSQVQAVECRNQLDSSAVAPHYCSAHSKLPK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining