Invitrogen™ Human ADAMTS12 (aa 116-204) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP108646	100 μL

Catalog No. RP108646 Supplier Invitrogen™ Supplier No. RP108646

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84973. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This protein is a disintegrin and metalloproteinase with thrombospondin motifs-12 (ADAMTS12), which is a member of the ADAMTS protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS-1) motif. Individual members of this family differ in the number of C-terminal TS-1 motifs, and some have unique C-terminal domains. The enzyme encoded by this gene contains eight TS-1 motifs. It may play roles in pulmonary cells during fetal development or in tumor processes through its proteolytic activity or as a molecule potentially involved in regulation of cell adhesion.

Specifications

• Accession Number: P58397
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 81792
• Name: Human ADAMTS12 (aa 116-204) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: a disintegrin and metalloproteinase; A disintegrin and metalloproteinase with thrombospondin motifs 12; a disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 12; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 12; a disintegrin-like and metalloprotease with thrombospondin type 1 motif, 12; ADAM; ADAM metallopeptidase with thrombospondin type 1 motif 12; ADAM metallopeptidase with thrombospondin type 1 motif, 12; ADAMs; ADAM-TS 12; ADAMTS12; ADAM-TS12; ADAMTS-12; AI605170; metalloendopeptidases; metalloprotease disintegrin 12; PRO4389; UNQ1918; UNQ1918/PRO4389
• Common Name: ADAMTS12
• Gene Symbol: ADAMTS12
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SYIMEKRYGNLSHVKMMASSAPLCHLSGTVLQQGTRVGTAALSACHGLTGFFQLPHGDFFIEPVKKHPLVEGGYHPHIVYRRQKVPETK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining