Invitrogen™ Human ADAMTS16 (aa 166-235) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP109138	100 μL

Catalog No. RP109138 Supplier Invitrogen™ Supplier No. RP109138

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (63%), Rat (63%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-144892, PA5-139886. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. ADAMTS family members share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The protein encoded by this gene has high sequence similarity to the protein encoded by ADAMTS18, another family member.

Specifications

• Accession Number: Q8TE57
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 170690
• Name: Human ADAMTS16 (aa 166-235) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: a disintegrin and metalloproteinase; A disintegrin and metalloproteinase with thrombospondin motifs 16; a disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 16; a disintegrin-like and metallopetidase (reprolysin type) with thrombospondin type 1 motif, 16; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 16; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 16 preproprotein; ADAM; ADAM metallopeptidase with thrombospondin type 1 motif 16; ADAM metallopeptidase with thrombospondin type 1 motif, 16; ADAMs; ADAM-TS 16; ADAMTS16; ADAM-TS16; ADAMTS-16; ADAMTS16s; KIAA2029; metalloendopeptidases
• Common Name: ADAMTS16
• Gene Symbol: ADAMTS16
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GLSGMIRTEEADYFLRPLPSHLSWKLGRAAQGSSPSHVLYKRSTEPHAPGASEVLVTSRTWELAHQPLHS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining