Invitrogen™ Human ADAT3 (aa 263-348) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP99241	100 μL

Catalog No. RP99241 Supplier Invitrogen™ Supplier No. RP99241

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63626. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a subunit of a tRNA-specific adenosine deaminase. This heterodimeric enzyme converts adenosine to inosine in the tRNA anticodon. A mutation in this gene causes a syndrome characterized by intellectual disability and strabismus. This gene shares its 5' exon with the overlapping gene, secretory carrier membrane protein 4. ADAT3 (Adenosine Deaminase TRNA Specific 3) is a Protein Coding gene. Diseases associated with ADAT3 include Neurodevelopmental Disorder With Brain Abnormalities, Poor Growth, And Dysmorphic Facies and Cone-Rod Dystrophy 10. Among its related pathways are tRNA processing and Processing of Capped Intron-Containing Pre-mRNA. Gene Ontology (GO) annotations related to this gene include hydrolase activity. An important paralog of this gene is ADAT2.

Specifications

• Accession Number: Q96EY9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 113179
• Name: Human ADAT3 (aa 263-348) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: ADAT3; adenosine deaminase, tRNA specific 3; adenosine deaminase, tRNA-specific 3; adenosine deaminase, tRNA-specific 3, TAD3 homolog; FWP005; MRT36; MST121; MSTP121; Probable inactive tRNA-specific adenosine deaminase-like protein 3; S863-5; TAD3; tRNA-specific adenosine deaminase 3 homolog; tRNA-specific adenosine deaminase-like protein 3; tRNA-specific adenosine-34 deaminase subunit ADAT3
• Common Name: ADAT3
• Gene Symbol: ADAT3
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GAVRKLDADEDGLPYLCTGYDLYVTREPCAMCAMALVHARILRVFYGAPSPDGALGTRFRIHARPDLNHRFQVFRGVLEEQCRWLD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining