Invitrogen™ Human ADO (aa 29-78) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP97197	100 μL

Catalog No. RP97197 Supplier Invitrogen™ Supplier No. RP97197

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (68%), Rat (68%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Human thiol dioxygenases include cysteine dioxygenase (CDO; MIM 603943) and cysteamine (2-amino ethane thiol) dioxygenase (ADO; EC 1.13.11.19). CDO adds 2 oxygen atoms to free cysteine, whereas ADO adds 2 oxygen atoms to free cysteamine to form hypotaurine.

Specifications

• Accession Number: Q96SZ5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 84890
• Name: Human ADO (aa 29-78) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2-aminoethanethiol (cysteamine) dioxygenase; 2-aminoethanethiol dioxygenase; ADO; C10orf22; cysteamine (2-aminoethanethiol) dioxygenase (ADO); cysteamine dioxygenase; Gm237
• Common Name: ADO
• Gene Symbol: ADO
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GASDRDAASGPEAPMQPGFPENLSKLKSLLTQLRAEDLNIAPRKATLQPL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining