Invitrogen™ Human ADPRM (aa 175-246) Control Fragment Recombinant Protein

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54740 (PA5-54740. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ADPRM (ADP-ribose/CDP-alcohol diphosphatase) is a protein that belongs to the Nudix hydrolase family. It plays a crucial role in the metabolism of nucleotide sugars and nucleotide sugar alcohols, which are important for glycosylation reactions in cells.

Specifications

• Accession Number: Q3LIE5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 56985
• Name: Human ADPRM (aa 175-246) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2310004I24Rik; ADPRibase-Mn; ADP-ribose/CDP-alcohol diphosphatase, manganese dependent; ADP-ribose/CDP-alcohol diphosphatase, manganese-dependent; ADP-ribose/CDP-alcohol pyrophosphatase; Adprm; C17orf48; CDP-choline phosphohydrolase; liver manganese (II)-dependent ADP-ribose/CDP-alcohol pyrophosphatase; manganese-dependent ADP-ribose/CDP-alcohol diphosphatase; Manganese-dependent ADP-ribose/CDP-alcohol diphosphatase-like protein; MDS006; NBLA03831; RGD1309906
• Common Name: ADPRM
• Gene Symbol: ADPRM
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QSSPKYEQCMKILREHNPNTELNSPQGLSEPQFVQFNGGFSQEQLNWLNEVLTFSDTNQEKVVIVSHLPIYP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining