Invitrogen™ Human AFF1 (aa 1023-1086) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP107722	100 μL

Catalog No. RP107722 Supplier Invitrogen™ Supplier No. RP107722

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67082. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Proto-oncogene AF-4 (or FEL) is a product of a chromosomal aberration of the human gene AFF1, which is associated with acute leukemias. The fusion of AF-4 on chromosome band 4q21 with the mixed lineage leukemia (MLL or HRX) gene on 11q23 results in a MLL-AF-4 chimeric transcription factor in which AF-4 contributes transcriptional effector properties and requires cell-specific accessory factors. MLL is involved in several chromosomal translocations associated with acute myeloid and lymphoid leukemia. The MLL-AF-4 fusion protein is expressed in all normal hematopoietic cells.

Specifications

• Accession Number: P51825
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 4299
• Name: Human AFF1 (aa 1023-1086) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 9630032B01Rik; AF4; AF4/FMR2 family member 1; AF4/FMR2 family, member 1; AFF1; ALL1-fused gene from chromosome 4 protein; AW319193; FEL; homolog of human MLLT2 unidentified; MLLT2; Mllt2h; myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 2; myeloid/lymphoid or mixed-lineage leukemia translocated to 2 homolog; PBM1; pre-B-cell monocytic leukemia partner 1; protein AF-4; Protein FEL; Proto-oncogene AF4; Rob; robotic; translocated to, 2
• Common Name: AFF1
• Gene Symbol: AFF1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VDLIKFIMSLKSFSDATAPTQEKIFAVLCMRCQSILNMAMFRCKKDIAIKYSRTLNKHFESSSK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining