Invitrogen™ Human Aggrecan (aa 382-449) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP105948	100 μL

Catalog No. RP105948 Supplier Invitrogen™ Supplier No. RP105948

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Aggrecan also known as cartilage-specific proteoglycan core protein (CSPCP) or chondroitin sulfate proteoglycan 1 is a protein that is encoded by the ACAN gene. The encoded protein is an integral part of the extracellular matrix in cartilaginous tissue and it withstands compression in cartilage. The human form of the protein is 2316 amino acids long (approximately 250 kDa) and can be expressed in multiple isoforms due to alternative splicing. Aggrecan exhibits a bottlebrush structure, in which chondroitin sulfate and keratan sulfate chains are attached to an extended protein core. The synthesis and degradation of aggrecan are being investigated for their roles in cartilage deterioration during joint injury, disease, and aging. It contains three interglobular domains (IGDs), G1, G2, and G3 that are involved in aggregation, hyaluronan binding, cell adhesion, and chondrocyte apoptosis. Aggrecan fragments from articular cartilage are released into the synovial fluid at all stages of human osteoarthritis as a result of cleavage by aggrecanase and MMP activity. Antibodies BC-3 and BC-4 can be used to detect these neo epitopes of Aggrecanase (ARGSVXXX) and MMP (XXXVDIPEN), respectively.

Specifications

• Accession Number: P16112
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 176
• Name: Human Aggrecan (aa 382-449) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: ACAN; Agc; Agc1; AGCAN; aggrecan; aggrecan 1; aggrecan 1 (chondroitin sulfate proteoglycan 1, large aggregating proteoglycan, antigen identified by monoclonal antibody A0122); aggrecan core protein; Aggrecan core protein 2; aggrecan CS2 domain; aggrecan epidermal growth factor-like domain-1; aggrecan G2 domain; aggrecan interglobular domain; aggrecan keratan sulfate domain; aggrecan, structural proteoglycan of cartilage; articular cartilage aggrecan precursor; b2b183Clo; cartilage aggregating proteoglycan; cartilage-specific proteoglycan core protein; Chondroitin sulfate proteoglycan 1; chondroitin sulfate proteoglycan core protein 1; cmd; CSPCP; CSPG1; CSPGCP; high density cartilage proteoglycan; large aggregating cartilage proteoglycan core protein; large aggregating proteoglycan; large aggregating proteoglycan, antigen; MSK16; SEDK
• Common Name: Aggrecan
• Gene Symbol: ACAN
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LPLPRNITEGEARGSVILTVKPIFEVSPSPLEPEEPFTFAPEIGATAFAEVENETGEATRPWGFPTPG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining