Invitrogen™ Human AGPAT2 (aa 211-273) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP91098	100 μL

Catalog No. RP91098 Supplier Invitrogen™ Supplier No. RP91098

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (63%), Rat (63%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54020. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Lysophospholipid acyltransferases (LPLATs) catalyse the addition of fatty acyl moieties to the glycerol backbone of lysophospholipids. In addition to playing a crutial role in the synthesis of structural membrane components the LPLATs are also implicated in cellular signalling responses for cytokines, growth factors and other agonists. Cellular signalling through the interleukin 1 receptor in human mesangial cells and EL-4 cells proceeds by the activation of lysophosphatidic acid acyltransferase (LPAAT). Activation of LPAAT by interleukin 1 results in the generation of unsaturated phosphatidic acid species, that are crucial to the generation of diacylglycerol and interleukin 1 signalling. LPLATs are also involved in signalling for increased interleukin 2 synthesis through the T cell antigen receptor. Activation of T-cells via anti-CD3 stimulation has been shown to increase incorporation of polyunsaturated fatty acids intophosphatidylcholine via lysophosphatidylcholine acyltransferase.Activation of this enzyme is essential for the sustained activationand translocation of protein kinase C.

Specifications

• Accession Number: O15120
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 10555
• Name: Human AGPAT2 (aa 211-273) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 1-acylglycerol-3-phosphate O-acyltransferase 2; 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta); 1-acyl-sn-glycerol-3-phosphate acyltransferase beta; 1-AGP acyltransferase 2; 1-AGPAT 2; 1-AGPAT2; 2510002J07Rik; AGPAT2; AV000834; BSCL; BSCL1; LPAAB; LPAAT-beta; lysophosphatidic acid acyltransferase beta; lysophosphatidic acid acyltransferase-beta; testicular tissue protein Li 143
• Common Name: AGPAT2
• Gene Symbol: AGPAT2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YNTKKKFFTSGTVTVQVLEAIPTSGLTAADVPALVDTCHRAMRTTFLHISKTPQENGATAGSG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining