Invitrogen™ Human AHA1 (aa 166-313) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP88922	100 μL

Catalog No. RP88922 Supplier Invitrogen™ Supplier No. RP88922

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51480. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Acts as a co-chaperone of HSP90AA1 (PubMed:29127155). Activates the ATPase activity of HSP90AA1 leading to increase in its chaperone activity (PubMed:29127155). Competes with the inhibitory co-chaperone FNIP1 for binding to HSP90AA1, thereby providing a reciprocal regulatory mechanism for chaperoning of client proteins (PubMed:27353360). Competes with the inhibitory co-chaperone TSC1 for binding to HSP90AA1, thereby providing a reciprocal regulatory mechanism for chaperoning of client proteins (PubMed:29127155). [UniProt].

Specifications

• Accession Number: O95433
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 10598
• Name: Human AHA1 (aa 166-313) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: Activator of 90 kDa heat shock protein ATPase homolog 1; activator of Hsp90 ATPase activity 1; Activator of Hsp90 ATPase protein 1; Aha 1; AHA1; AHA1, activator of heat shock 90kDa protein ATPase homolog 1; AHA1, activator of heat shock 90kDa protein ATPase homolog 1 (yeast); AHA1, activator of heat shock protein ATPase 1; AHA1, activator of heat shock protein ATPase homolog 1; Aha1p; AHSA 1; Ahsa1; BC023857; C14orf3; hAha1; Hsp90 co-chaperone AHA1; HSPC322; p38; SHSA1; YD8142.16; YD8142B.06; YDR214W
• Common Name: AHA1
• Gene Symbol: Ahsa1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PTMNGESVDPVGQPALKTEERKAKPAPSKTQARPVGVKIPTCKITLKETFLTSPEELYRVFTTQELVQAFTHAPATLEADRGGKFHMVDGNVSGEFTDLVPEKHIVMKWRFKSWPEGHFATITLTFIDKNGETELCMEGRGIPAPEEE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining