Invitrogen™ Human AIMP2 (aa 110-196) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP92672	100 μL

Catalog No. RP92672 Supplier Invitrogen™ Supplier No. RP92672

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

JTV1 is probable core protein of the multisynthetase complex that serves as a template for the assembly of the supramolecular structure. This protein Mediates ubiquitination of FUBP1 and its degradation by the proteasome.

Specifications

• Accession Number: Q13155
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 7965
• Name: Human AIMP2 (aa 110-196) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AA407136; AA407225; AIMP2; Aimp2(p38); Aminoacyl tRNA synthase complex-interacting multifunctional protein 2; aminoacyl tRNA synthetase complex interacting multifunctional protein 2; aminoacyl tRNA synthetase complex-interacting multifunctional protein 2; ARS interacting multifunctional protein 2; ARS-interacting multi-functional protein 2; JTV1; JTV-1; multisynthase complex auxiliary component p38; multisynthetase complex auxiliary component p38; P38; PRO0992; Protein JTV-1
• Common Name: AIMP2
• Gene Symbol: AIMP2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SVLGKDYGALKDIVINANPASPPLSLLVLHRLLCEHFRVLSTVHTHSSVKSVPENLLKCFGEQNKKQPRQDYQLGFTLIWKNVPKTQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining