Invitrogen™ Human AKAP1 (aa 223-363) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP90162	100 μL

Catalog No. RP90162 Supplier Invitrogen™ Supplier No. RP90162

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (35%), Rat (35%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes an enzyme which reversibly catalyzes the phosphorolysis of purine nucleosides. The enzyme is trimeric, containing three identical subunits. Mutations which result in nucleoside phosphorylase deficiency result in defective T-cell (cell-mediated) immunity but can also affect B-cell immunity and antibody responses. Neurologic disorders may also be apparent in patients with immune defects. A known polymorphism at aa position 51 that does not affect enzyme activity has been described. A pseudogene has been identified on chromosome 2.

Specifications

• Accession Number: Q92667
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 8165
• Name: Human AKAP1 (aa 223-363) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: A kinase (PRKA) anchor protein 1; a kinase anchor protein 1, mitochondrial; Akap; AKAP 121; AKAP 149; Akap1; AKAP121; AKAP149; AKAP84; A-kinase anchor protein 1, mitochondrial; A-kinase anchor protein 121 kDa; A-kinase anchor protein 149 kDa; A-kinase anchoring protein 1; C76494; C81186; DAKAP1; D-AKAP1; D-AKAP-1; Dual specificity A-kinase-anchoring protein 1; dual-specificity A-kinase anchoring protein 1; PPP1R43; PRKA1; protein kinase A anchoring protein 1; protein kinase A1; protein kinase A-anchoring protein 1; protein phosphatase 1, regulatory subunit 43; S-AKAP; SAKAP84; S-AKAP84; spermatid A-kinase; Spermatid A-kinase anchor protein; spermatid A-kinase anchor protein 84; TDRD17; testicular secretory protein Li 5; tudor domain containing 17
• Common Name: AKAP1
• Gene Symbol: AKAP1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EHVLELENSKGPSLASLEGEEDKGKSSSSQVVGPVQEEEYVAEKLPSRFIESAHTELAKDDAAPAPPVADAKAQDRGVEGELGNEESLDRNEEGLDRNEEGLDRNEESLDRNEEGLDRNEEIKRAAFQIISQVISEATEQV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining