Invitrogen™ Human alanyl-tRNA Synthetase (aa 560-672) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP104790	100 μL

Catalog No. RP104790 Supplier Invitrogen™ Supplier No. RP104790

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83712. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The human alanyl-tRNA synthetase (AARS) belongs to a family of tRNA synthases, of the class II enzymes. Class II tRNA synthases evolved early in evolution and are highly conserved. This is reflected by the fact that 498 of the 968-residue polypeptide human AARS shares 41% identity witht the E. coli protein. tRNA synthases are the enzymes that interpret the RNA code and attach specific aminoacids to the tRNAs that contain the cognate trinucleotide anticodons. They consist of a catalytic domain which interacts with the amino acid acceptor-T psi C helix of the tRNA, and a second domain which interacts with the rest of the tRNA structure.

Specifications

• Accession Number: P49588
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 16
• Name: Human alanyl-tRNA Synthetase (aa 560-672) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: Aars; AI316495; alanine tRNA ligase 1, cytoplasmic; alanine--tRNA ligase, cytoplasmic; alanine--tRNA ligase, cytoplasmic {ECO:0000255; Alanyl-tRNA synthetase; alanyl-tRNA synthetase {ECO:0000255; alanyl-tRNA synthetase, cytoplasmic; alaRS; alaRS {ECO:0000255; C76919; CMT2N; EIEE29; HAMAP-Rule:MF_03133}; Protein sticky; Renal carcinoma antigen NY-REN-42; sti
• Common Name: alanyl-tRNA Synthetase
• Gene Symbol: AARS1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EFTVKNAQVRGGYVLHIGTIYGDLKVGDQVWLFIDEPRRRPIMSNHTATHILNFALRSVLGEADQKGSLVAPDRLRFDFTAKGAMSTQQIKKAEEIANEMIEAAKAVYTQDCP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining