Invitrogen™ Human ALAS2 (aa 139-287) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP92130	100 μL

Catalog No. RP92130 Supplier Invitrogen™ Supplier No. RP92130

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ALAS2 specifies an erythroid-specific mitochondrially located enzyme. It catalyzes the first step in the heme biosynthetic pathway. Defects in this gene cause X-linked pyridoxine-responsive sideroblastic anemia.The product of this gene specifies an erythroid-specific mitochondrially located enzyme. The encoded protein catalyzes the first step in the heme biosynthetic pathway. Defects in this gene cause X-linked pyridoxine-responsive sideroblastic anemia. Alternatively spliced transcript variants encoding different isoforms have been identified.

Specifications

• Accession Number: P22557
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 212
• Name: Human ALAS2 (aa 139-287) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 5'-aminolevulinate synthase 2; 5-aminolevulinate synthase 2; 5-aminolevulinate synthase, erythroid-specific, mitochondrial; 5-aminolevulinic acid synthase 2; ALAS; Alas2; Alas-2; alas2 protein; Alase; ALAS-E; Aminolevulinate synthase 2, delta; aminolevulinate synthase erythroid specific isoform; aminolevulinate, delta-, synthase 2; aminolevulinate, delta-, synthase 2 (sideroblastic/hypochromic anemia); aminolevulinate, delta-, synthetase 2; aminolevulinic acid synthase 2, erythroid; ANH1; ASB; cb1063; Delta-ALA synthase 2; delta-ALA synthetase; delta-ALA synthetase 2; delta-aminolevulinate synthase 2; erythroid aminolevulinate synthase; erythroid-specific ALAS; erythroid-specific delta-aminolevulinate synthase ALAS-E; heme biosynthetic enzyme; PRO2399; RP5-884M20.1; sau; sauternes; si:dkey-24f17.4; SIDBA1; XLDPP; XLEPP; XLSA
• Common Name: ALAS2
• Gene Symbol: ALAS2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GNYVFSYDQFFRDKIMEKKQDHTYRVFKTVNRWADAYPFAQHFSEASVASKDVSVWCSNDYLGMSRHPQVLQATQETLQRHGAGAGGTRNISGTSKFHVELEQELAELHQKDSALLFSSCFVANDSTLFTLAKILPGCEIYSDAGNHAS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining