Invitrogen™ Human ALDH1B1 (aa 329-379) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP109612	100 μL

Catalog No. RP109612 Supplier Invitrogen™ Supplier No. RP109612

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Aldehyde dehydrogenases (ALDHs) mediate NADP+-dependent oxidation of aldehydes into acids during detoxification of alcohol-derived acetaldehyde, lipid peroxidation and metabolism of corticosteroids, biogenic amines and neurotransmitters. Alcohol drinking habits and cardiovascular disease risk factors may be associated with ALDH gene variants. ALDH1B1 (Aldehyde dehydrogenase family 1 member B1), also known as ALDH5 or ALDHX (Aldehyde dehydrogenase X, mitochondrial), is a 517 amino acid mitochondrial protein that is expressed in the liver, testis and to a lesser extent in brain. ALDH1B1 belongs to the aldehyde dehydrogenase family and may play a major role in ethanol detoxification.

Specifications

• Accession Number: P30837
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 219
• Name: Human ALDH1B1 (aa 329-379) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2700007F14Rik; acetaldehyde dehydrogenase 5; aldehyde dehydrogenase 1 family member B1; aldehyde dehydrogenase 1 family, member B1; aldehyde dehydrogenase 1B1; aldehyde dehydrogenase 5; Aldehyde dehydrogenase family 1 member B1; aldehyde dehydrogenase X, mitochondrial; ALDH class 2; ALDH1B1; ALDH5; ALDHX; MGC2230
• Common Name: ALDH1B1
• Gene Symbol: ALDH1B1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ESIYNEFLERTVEKAKQRKVGNPFELDTQQGPQVDKEQFERVLGYIQLGQK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining