Invitrogen™ Human Aldolase C (aa 1-78) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP102036	100 μL

Catalog No. RP102036 Supplier Invitrogen™ Supplier No. RP102036

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the class I fructose-biphosphate aldolase gene family. Expressed specifically in the hippocampus and Purkinje cells of the brain, the encoded protein is a glycolytic enzyme that catalyzes the reversible aldol cleavage of fructose-1,6-biphosphate and fructose 1-phosphate to dihydroxyacetone phosphate and either glyceraldehyde-3-phosphate or glyceraldehyde, respectively. [provided by RefSeq, Jul 2008].

Specifications

• Accession Number: P09972
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 230
• Name: Human Aldolase C (aa 1-78) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AI847350; ALDC; ALDCAA; Aldo3; ALDOC; Aldolase 3; aldolase C, fructose-biphosphate; aldolase C, fructose-bisphosphate; aldolase, fructose-bisphosphate C; AU040929; Brain-type aldolase; EC 4.1.2.13; F16dip7; fructoaldolase C; fructose-1,6-biphosphate triosephosphate lyase; fructose-bisphosphate aldolase C; RATALDCAA; Scrapie-responsive protein 2; Scrg2; Zebrin II
• Common Name: Aldolase C
• Gene Symbol: ALDOC
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLFSADDRVKKCIGGVI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining