Invitrogen™ Human ALKBH4 (aa 43-114) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP98508	100 μL

Catalog No. RP98508 Supplier Invitrogen™ Supplier No. RP98508

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62407. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Dioxygenase that mediates demethylation of actin monomethylated at 'Lys-84' (K84me1), thereby acting as a regulator of actomyosin-processes (PubMed:23673617). Demethylation of actin K84me1 is required for maintaining actomyosin dynamics supporting normal cleavage furrow ingression during cytokinesis and cell migration (PubMed:23673617). In addition to proteins, also demethylates DNA: specifically demethylates DNA methylated on the 6th position of adenine (N(6)-methyladenosine) DNA, thereby regulating Polycomb silencing. [UniProt].

Specifications

• Accession Number: Q9NXW9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 54784
• Name: Human ALKBH4 (aa 43-114) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2010004B12Rik; ABH4; Abj4; alkB homolog 4, lysine demethylase; alkB homolog 4, lysine demthylase; alkB, alkylation repair homolog 4; alkB, alkylation repair homolog 4 (E. coli); Alkbh4; Alkylated DNA repair protein alkB homolog 4; alpha-ketoglutarate-dependent dioxygenase alkB homolog 4; DNA N6-methyl adenine demethylase ALKBH4; Lysine-specific demethylase ALKBH4; probable alpha-ketoglutarate-dependent dioxygenase ABH4; RGD1308608
• Common Name: ALKBH4
• Gene Symbol: ALKBH4
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TYRFIYCSDTGWAVGTEESDFEGWAFPFPGVMLIEDFVTREEEAELVRLMDRDPWKLSQSGRRKQDYGPKVN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining