Invitrogen™ Human ALOX12 (aa 551-651) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP90628	100 μL

Catalog No. RP90628 Supplier Invitrogen™ Supplier No. RP90628

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52728. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The ALOX12 gene encodes the enzyme arachidonate 12-lipoxygenase, a member of the lipoxygenase family that metabolizes arachidonic acid into bioactive lipid mediators. ALOX12 catalyzes the formation of 12-hydroperoxyeicosatetraenoic acid (12-HPETE), which is further reduced to 12-hydroxyeicosatetraenoic acid (12-HETE). These products are involved in various biological processes, including inflammation, cellular signaling, and blood platelet function. ALOX12 plays a significant role in pathophysiological conditions such as cancer, cardiovascular diseases, and inflammatory disorders. Dysregulation or altered expression of ALOX12 has been implicated in tumorigenesis and metastasis, where its metabolites influence cell proliferation, migration, and survival. Additionally, ALOX12 impacts platelet aggregation and inflammation, making it a potential target for therapeutic strategies aimed at treating diseases linked to lipid mediator imbalances. Research into ALOX12 continues to explore its functions in health and disease, emphasizing its importance in lipid metabolism and signaling pathways.

Specifications

• Accession Number: P18054
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 239
• Name: Human ALOX12 (aa 551-651) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 12(S)-lipoxygenase; 12LO; 12-LO; 12LOX; 12-LOX; 12S LOX; 12S-lipoxygenase; 12S-LOX; 9930022G08Rik; ALOX12; Alox12p; arachidonate 12-lipoxygenase; arachidonate 12-lipoxygenase, 12S type; arachidonate 12-lipoxygenase, 12S-type; Arachidonate 15-lipoxygenase,15S-type; Linoleate 13S-lipoxygenase; Lipoxin synthase 12-LO; LOG12; P-12LO; platelet 12-LOX; platelet-type 12-lipoxygenase; platelet-type lipoxygenase 12
• Common Name: ALOX12
• Gene Symbol: ALOX12
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YAWVPNAPCTMRMPPPTTKEDVTMATVMGSLPDVRQACLQMAISWHLSRRQPDMVPLGHHKEKYFSGPKPKAVLNQFRTDLEKLEKEITARNEQLDWPYEY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining