Invitrogen™ Human alpha-1 Antitrypsin Control Fragment Recombinant Protein

Catalog No.	Quantity
RP98843	100 μL

Catalog No. RP98843 Supplier Invitrogen™ Supplier No. RP98843

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (60%), Rat (60%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Alpha-1-AT is synthesized in the liver and it acts as an inhibitor of proteases such as trypsin, elastase, chymotrypsin, collagenase, leucocytic proteases, plasmin, and thrombin, which may be released during inflammatory reactions in the lung. In the absence of alpha-1-AT, these enzymes are not inhibited and they may digest pulmonary parenchyma. Alpha-1-AT deficiency is associated with chronic obstructive lung disease (emphysema) and less frequently with hepatic cirrhosis in infants and respiratory distress of the newborn. Increase in alpha-1-AT occurs as an acute phase response to tissue necrosis and inflammation. Serum level of alpha-1-AT is elevated in rheumatoid arthritis, bacterial infections, vasculitis, and carcinomatosis.

Specifications

• Accession Number: P01009
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 5265
• Name: Human alpha-1 Antitrypsin Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: a-1 AT; A1A; a1-antitrypsin; A1AT; AAT; Aat2; Aat-2; alpha 1 antitrypsin; alpha-1 antitrypsin; alpha-1 protease inhibitor; Alpha-1 protease inhibitor 1; alpha-1-antiproteinase; Alpha-1-antitrypsin; alpha-1-antitrypsin (protease inhibitor); alpha-1-antitrypsin 1-1; alpha-1-antitrypsin 2; alpha-1-antitrypsin null; alpha1AT; alpha-1-protease inhibitor; alpha-1-proteinase inhibitor; Digestive Zymogen; Dom1; MGC23330; MGC9222; PI; PI1; PRO0684; PRO2209; PRO2275; protease inhibitor 1 (anti-elastase), alpha-1-antitrypsin; protease inhibitor 1 (anti-elastase, antitrypsin, alpha-1); Protease Serine 1; serine (or cysteine) peptidase inhibitor, clade A, member 1A; serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1; serine (or cysteine) proteinase inhibitor, clade A (alpha-1antiproteinase, antitrypsin), member 1; serine (or cysteine) proteinase inhibitor, clade A, member 1; serine (or cysteine) proteinase inhibitor, clade A, member 1a; Serine Protease 1; serine protease inhibitor 1-1; Serine protease inhibitor A1a; serine protease inhibitor alpha 1; serine proteinase inhibitor, clade A, member 1; serpin A1; Serpin A1a; serpin family A member 1; serpin peptidase inhibitor clade A member 1; serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1; SERPINA1; Serpina1a; Short peptide from AAT; SPAAT; Spi1; Spi1-1; Spi1-3; TRP1; TRY1
• Common Name: alpha-1 Antitrypsin
• Gene Symbol: SERPINA1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMGAPHR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining