Invitrogen™ Human Alpha Sarcoglycan (aa 177-289) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP90085	100 μL

Catalog No. RP90085 Supplier Invitrogen™ Supplier No. RP90085

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52450. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The sarcoglycan transmembrane proteins are members of the dystrophin complex. Sarcoglycans cluster together to form a complex, which is localized in the cell membrane of skeletal, cardiac, and smooth muscle fibers. Four sarcoglycan subunit proteins, designated alpha-, beta-, gamma- and delta-sarcoglycan, form a complex on the skeletal muscle cell surface membrane. A genetic defect in any one of these proteins causes the loss or marked decrease of the whole sarcoglycan complex, which is observed in the autosomal recessive muscular dystrophy, sarcoglycanopathy. In smooth muscle, beta- and delta-sarcoglycans are associated with epsilon-sarcoglycan, a glycoprotein homologous to alpha-sarcoglycan. Additionally, a complete deficiency in delta-sarcoglycan is the cause of the Syrian hamster BIO.14 cardiomyopathy.

Specifications

• Accession Number: Q16586
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 6442
• Name: Human Alpha Sarcoglycan (aa 177-289) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 50 kDa dystrophin-associated glycoprotein; 50DAG; 50kD DAG; adhalin; ADL; Alpha-sarcoglycan; alpha-SG; Asg; DAG2; DMDA2; Dystroglycan 2; Dystroglycan2; dystroglycan-2; LGMD2D; limb girdle muscular dystrophy 2D; sarcoglycan alpha; sarcoglycan, alpha (50kDa dystrophin-associated glycoprotein); sarcoglycan, alpha (dystrophin-associated glycoprotein); SCARMD1; SG alpha; SG-alpha; Sgca
• Common Name: Alpha Sarcoglycan
• Gene Symbol: SGCA
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SALDRGGRVPLPIEGRKEGVYIKVGSASPFSTCLKMVASPDSHARCAQGQPPLLSCYDTLAPHFRVDWCNVTLVDKSVPEPADEVPTPGDGILEHDPFFCPPTEAPDRDFLVD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining