Invitrogen™ Human AMPK gamma-1 (aa 1-30) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP108125	100 μL

Catalog No. RP108125 Supplier Invitrogen™ Supplier No. RP108125

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (67%), Rat (67%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67469. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit is one of the gamma regulatory subunits of AMPK. Alternatively spliced transcript variants encoding distinct isoforms have been observed.

Specifications

• Accession Number: P54619
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 5571
• Name: Human AMPK gamma-1 (aa 1-30) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 5'-AMP-activated protein kinase subunit gamma-1; 5'-AMP-activated protein kinase, gamma-1 subunit; AA571379; AMP-activated protein kinase, noncatalytic gamma-1 subunit; ampk gamma; AMPK gamma1; AMPK gamma-1 chain; AMPK subunit gamma-1; AMPKG; BB036179; Prkaac; PRKAG1; Prkga1; Protein kinase AMP-activated gamma; protein kinase AMP-activated non-catalytic subunit gamma 1; protein kinase, AMP-activated, gamma 1 non-catalytic subunit
• Common Name: AMPK gamma-1
• Gene Symbol: PRKAG1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: METVISSDSSPAVENEHPQETPESNNSVYT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining