Invitrogen™ Human ANKLE1 (aa 359-438) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP107936	100 μL

Catalog No. RP107936 Supplier Invitrogen™ Supplier No. RP107936

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (57%), Rat (57%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67297. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Endonuclease that probably plays a role in the DNA damage response and DNA repair.

Specifications

• Accession Number: Q8NAG6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 126549
• Name: Human ANKLE1 (aa 359-438) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 8430438L13Rik; Ankle1; Ankrd41; ankyrin repeat and LEM domain containing 1; ankyrin repeat and LEM domain-containing protein 1; ankyrin repeat domain 41; ankyrin repeat domain-containing protein 41; C430003I23; LEM domain containing 6; Lem3; LEMD6; LEM-domain containing 3; LEM-domain containing protein 3; RGD1308184
• Common Name: ANKLE1
• Gene Symbol: ANKLE1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: STVSDLELLKGLRALGENPHPITPFTRQLYHQQLEEAQIAPGPEFSGHSLELAAALRTGCIPDVQADEDALAQQFEQPDP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining