Invitrogen™ Human Annexin A4 (aa 4-131) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP88718	100 μL

Catalog No. RP88718 Supplier Invitrogen™ Supplier No. RP88718

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82296. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Annexin IV (ANX4) belongs to the annexin family of calcium-dependent phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. ANX4 has 45 to 59% identity with other members of its family and shares a similar size and exon-intron organization. Isolated from human placenta, ANX4 encodes a protein that has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. ANX4 is almost exclusively expressed in epithelial cells.

Specifications

• Accession Number: P09525
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 307
• Name: Human Annexin A4 (aa 4-131) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 35-beta calcimedin; 36 kDa zymogen granule membrane-associated protein; AI265406; AIV; annexin 4; annexin A4; Annexin IV; annexin IV (placental anticoagulant protein II); annexin-4; ANX IV; ANX4; ANXA 4; Anxa4; ANXIV; AW106930; Carbohydrate-binding protein p33/p41; chromobindin-4; endonexin; endonexin I; epididymis secretory protein Li 274; HEL-S-274; Lipocortin IV; P32.5; p33/41 (annexin IV); PAP-II; PIG28; Placental anticoagulant protein II; PP4-X; proliferation-inducing gene 28; proliferation-inducing protein 28; Protein II; unnamed protein product; Xanx-4; ZAP 36/annexin IV; ZAP36; zymogen granule membrane associated protein
• Common Name: Annexin A4
• Gene Symbol: ANXA4
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KGGTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRISQTYQQQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining