Invitrogen™ Human ANP (aa 91-148) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP109056	100 μL

Catalog No. RP109056 Supplier Invitrogen™ Supplier No. RP109056

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene belongs to the natriuretic peptide family. Natriuretic peptides are implicated in the control of extracellular fluid volume and electrolyte homeostasis. This protein is synthesized as a large precursor (containing a signal peptide), which is processed to release a peptide from the N-terminus with similarity to vasoactive peptide, cardiodilatin, and another peptide from the C-terminus with natriuretic-diuretic activity. Mutations in this gene have been associated with atrial fibrillation familial type 6.

Specifications

• Accession Number: P01160
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 4878
• Name: Human ANP (aa 91-148) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: Anf; ANP; ATFB6; atrial natriuretic factor; Atrial natriuretic peptide; atriopeptin; Atriopeptin I; Atriopeptin II; Atriopeptin III; Atriopeptin-1; Atriopeptin-2; Atriopeptin-3; ATRST2; Auriculin-A; Auriculin-B; Cardiodilatin; Cardiodilatin-related peptide; cardionatrin; CDD; CDD-ANF; CDP; natriuretic peptide A; Natriuretic peptide precursor A (pronatriodilatin, also Anf, Pnd); natriuretic peptide precursor A variant 1; natriuretic peptide precursor A variant NPPA-M1; natriuretic peptide precursor A variant NPPA-M2; natriuretic peptide precursor A variant NPPA-M3; natriuretic peptide precursor type A; natriuretic peptide type A; natriuretic peptides A; Nppa; Pnd; Prepronatriodilatin; Pronatriodilatin; RATANF; urodilatin
• Common Name: ANP
• Gene Symbol: NPPA
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QRDGGALGRGPWDSSDRSALLKSKLRALLTAPRSLRRSSCFGGRMDRIGAQSGLGCNS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining