Invitrogen™ Human AP1M2 (aa 383-423) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP110236	100 μL

Catalog No. RP110236 Supplier Invitrogen™ Supplier No. RP110236

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145158. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a subunit of the heterotetrameric adaptor-related protein comlex 1 (AP-1), which belongs to the adaptor complexes medium subunits family. This protein is capable of interacting with tyrosine-based sorting signals. Alternative splicing results in multiple transcript variants.

Specifications

• Accession Number: Q9Y6Q5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 10053
• Name: Human AP1M2 (aa 383-423) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: [m]1B; adaptor protein complex AP-1 mu-2 subunit; adaptor protein complex AP-1 subunit mu-2; adaptor protein complex AP-1, mu 2 subunit; adaptor related protein complex 1 mu 2 subunit; adaptor-related protein complex 1 mu 2 subunit; adaptor-related protein complex 1 mu-2 subunit; adaptor-related protein complex 1 subunit mu-2; adaptor-related protein complex 1, mu 2 subunit; adaptor-related protein complex AP-1, mu 2 subunit; AP-1 complex subunit mu-2; Ap1m2; AP1-mu2; AP-mu chain family member mu1B; clathrin assembly protein complex 1 medium chain 2; clathrin assembly protein complex 1 mu-2 medium chain 2; clathrin coat assembly protein AP47 2; clathrin coat associated protein AP47 2; clathrin-associated adaptor medium chain mu2; D9Ertd818e; golgi adaptor AP-1 47 kDa protein; golgi adaptor HA1/AP1 adaptin mu-2 subunit; HA1 47 kDa subunit 2; HSMU1B; MU1B; MU-1B; Mu1B-adaptin; mu2; Mu-adaptin 2; RGD1561490
• Common Name: AP1M2
• Gene Symbol: AP1M2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PYFTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLRTS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining