Invitrogen™ Human AP4S1 (aa 91-156) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP98361	100 μL

Catalog No. RP98361 Supplier Invitrogen™ Supplier No. RP98361

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (34%), Rat (34%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59011. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the adaptor complexes small subunit protein family. These proteins are components of the heterotetrameric adaptor protein complexes, which play important roles in the secretory and endocytic pathways by mediating vesicle formation and sorting of integral membrane proteins. The encoded protein is the small subunit of adaptor protein complex-4, which is associated with both clathrin- and nonclathrin-coated vesicles. Mutations in this gene are associated with spastic quadriplegic cerebral palsy-6. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 6.

Specifications

• Accession Number: Q9Y587
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 11154
• Name: Human AP4S1 (aa 91-156) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: adapter-related protein complex 4 subunit sigma-1; adaptor related protein complex 4 sigma 1 subunit; adaptor related protein complex 4 subunit sigma 1; adaptor related protein complex 4, sigma 1 subunit; adaptor-related protein complex 4 subunit sigma-1; adaptor-related protein complex 4, sigma 1 subunit; adaptor-related protein complex AP-4, sigma 1; AI314282; AP4; AP-4 adapter complex subunit sigma-1; AP-4 adaptor complex subunit sigma-1; AP-4 complex subunit sigma-1; AP47B; Ap4s1; ap4s1 protein; CLA20; CLAPS4; clathrin-associated/assembly/adaptor protein, sigma 4; CPSQ6; LOC618267 protein; si:dz115o7.1; si:dz234g15.5; sigma-1 subunit of AP-4; Sigma-4-adaptin; sigma4-adaptin; SPG52; zgc:136677
• Common Name: AP4S1
• Gene Symbol: AP4S1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LDEYFSRVSELDVSFFNTVFHSTWQMHSGPYQEPIDELPKICSALEPQQTCFSPDSSSFKGAASTT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining